PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0184600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 239aa    MW: 26800.1 Da    PI: 5.6836
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0184600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+ +   G  +W+++++  g+ R++k+c++rw +yl
   Spipo0G0184600 14 KGPWTAEEDKKLVNFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.42.6e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E+++ +d++ +lG++ W++Ia+ ++ gRt++++k++w+++
   Spipo0G0184600  70 LSESEEQIVIDLHSKLGNR-WSKIAASLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.355961IPR017930Myb domain
SuperFamilySSF466894.49E-2711108IPR009057Homeodomain-like
SMARTSM007174.2E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-141461IPR001005SANT/Myb domain
CDDcd001672.18E-81661No hitNo description
PROSITE profilePS5129426.89362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2564117IPR009057Homeodomain-like
SMARTSM007178.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.8E-1470111IPR001005SANT/Myb domain
CDDcd001671.00E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLVNFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEQIVID LHSKLGNRWS KIAASLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPQTHKPLD SGDGGQRGEA QMAEVGVGAE KASKTFPKST GEVAEEEGKS QSFCTDEVED  180
SQLPCIDWSE SIPWWSLDEI QGWDWLWDHS EGGLAVEDPF RDYGSSALDQ DSWSFSLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803475.11e-101PREDICTED: protein ODORANT1-like
SwissprotQ50EX63e-83ODO1_PETHY; Protein ODORANT1
TrEMBLM0TGZ08e-99M0TGZ0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P12520_0012e-98(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.16e-87myb domain protein 43